PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MELO3C017090P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family MYB
Protein Properties Length: 477aa    MW: 55296.5 Da    PI: 6.5444
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MELO3C017090P1genomeMELONOMICSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding61.32e-19193239148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g WT eEd llv++v+q+G + W+ Iar+++ gR +kqc++rw+++l
   MELO3C017090P1 193 KGQWTVEEDRLLVQLVEQYGVRKWSHIARMLP-GRIGKQCRERWHNHL 239
                      799*****************************.*************97 PP

2Myb_DNA-binding54.23.4e-17245287145
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                      ++ W++eEd  l++a+ + G++ W+ Ia++++ gRt++++k++w+
   MELO3C017090P1 245 KDTWSEEEDRVLIEAHSEIGNK-WAEIAKRLP-GRTENSIKNHWN 287
                      679*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129431.991188243IPR017930Myb domain
SuperFamilySSF466897.91E-33190286IPR009057Homeodomain-like
SMARTSM007175.4E-19192241IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.3E-28194247IPR009057Homeodomain-like
CDDcd001674.81E-16196239No hitNo description
PfamPF139211.1E-19196253No hitNo description
PROSITE profilePS5129422.266244294IPR017930Myb domain
SMARTSM007171.1E-16244292IPR001005SANT/Myb domain
CDDcd001675.87E-12247290No hitNo description
Gene3DG3DSA:1.10.10.605.3E-22248292IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010183Biological Processpollen tube guidance
GO:0045697Biological Processregulation of synergid differentiation
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 477 aa     Download sequence    Send to blast
MELENNLREE NLSTEICKKD ELLSSFEIVA SAKGNNYLQE FHHLDHQFHP IANSSSNNHV  60
MEEENLCSNF DSLNNNQYSH GIDQEMYEFN YKGNAAADQV MDNFQNCGDY YYYCNNFHQR  120
NHQIEIMGLE RNSINIPLNF PEIKPVNFMV PDEVSSIASA RNGHIQKGII NKNVNFSSLL  180
RTSKGRKKPN VIKGQWTVEE DRLLVQLVEQ YGVRKWSHIA RMLPGRIGKQ CRERWHNHLR  240
PDIKKDTWSE EEDRVLIEAH SEIGNKWAEI AKRLPGRTEN SIKNHWNATK RRQYSKRKCR  300
SKYPRCSLLQ DYIKSLNLDS NNAVRHQKKS SAAISSAVNN NTKSKSADHH HHHHHHQVQT  360
TDFCPNDWTV PDFDFKEEPE FYLDDSFFPE GCSINSLMED IVGASVDEAN NYDRKRYNNN  420
NDESVELRCV EMDKLQYYGP VSTATAAAGG MEFEVKKELD LVEMMSQVNE VNSMMK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h88_C5e-4518929354158MYB PROTO-ONCOGENE PROTEIN
1h89_C5e-4518929354158MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00442DAPTransfer from AT4G18770Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818130.0LN681813.1 Cucumis melo genomic scaffold, anchoredscaffold00030.
GenBankLN7132560.0LN713256.1 Cucumis melo genomic chromosome, chr_2.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008453673.10.0PREDICTED: transcription factor MYB98-like
SwissprotQ9S7L24e-94MYB98_ARATH; Transcription factor MYB98
TrEMBLA0A0A0LRG50.0A0A0A0LRG5_CUCSA; Uncharacterized protein
STRINGGLYMA05G02300.21e-130(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF15703196
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G18770.11e-93myb domain protein 98